PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0171s0340.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 198aa    MW: 22342.1 Da    PI: 4.7238
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0171s0340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM972.8e-30101261128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGf F+Ptdeelv ++L++k++  + +  ++i+++ +y ++Pw+L+ k+ ++ ++wy+Fs+  +k        ++t++g+Wk   
  SapurV1A.0171s0340.1.p  10 LPPGFVFSPTDEELVLHFLHRKASPLPSNP-SIIPDLTLYPHDPWQLEGKALSSGNQWYYFSQVMEK--------KVTENGFWKPLD 87 
                             79************************9877.78***************77778899******98775........5899******** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +++v+++ g++vglkk +v+   +  +g++t+W+m+ey+l
  SapurV1A.0171s0340.1.p  88 IEEPVFCNAGKKVGLKKYFVYC--NGAEGVETNWMMKEYHL 126
                             *********************9..667899*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-379155IPR003441NAC domain
PROSITE profilePS5100536.55710156IPR003441NAC domain
PfamPF023651.4E-1811126IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGDHGYSGNL PPGFVFSPTD EELVLHFLHR KASPLPSNPS IIPDLTLYPH DPWQLEGKAL  60
SSGNQWYYFS QVMEKKVTEN GFWKPLDIEE PVFCNAGKKV GLKKYFVYCN GAEGVETNWM  120
MKEYHLCSSK SSGTSSCKKK KKSDCHEWIL CRVYEREGSC IQNVGNSTED DDGTELSCLD  180
EMFLSMDDDL DDISFPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-28916019172NAC domain-containing protein 19
3swp_C5e-28916019172NAC domain-containing protein 19
3swp_B5e-28916019172NAC domain-containing protein 19
3swp_A5e-28916019172NAC domain-containing protein 19
3swm_D5e-28916019172NAC domain-containing protein 19
3swm_C5e-28916019172NAC domain-containing protein 19
3swm_B5e-28916019172NAC domain-containing protein 19
3swm_A5e-28916019172NAC domain-containing protein 19
4dul_B5e-28916016169NAC domain-containing protein 19
4dul_A5e-28916016169NAC domain-containing protein 19
1ut7_B5e-28916016169NO APICAL MERISTEM PROTEIN
1ut7_A5e-28916016169NO APICAL MERISTEM PROTEIN
1ut4_B5e-28916016169NO APICAL MERISTEM PROTEIN
1ut4_A5e-28916016169NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2165987e-77AC216598.1 Populus trichocarpa clone POP037-D13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310519.11e-124hypothetical protein POPTR_0007s04250g
SwissprotQ8GWK61e-59NC104_ARATH; NAC domain-containing protein 104
TrEMBLB9HES91e-124B9HES9_POPTR; Uncharacterized protein
STRINGPOPTR_0007s04250.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.11e-58xylem NAC domain 1